Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019497 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019497, RRID:AB_1854760
- Product name
- Anti-OBSCN
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RVDLTSTDYDTAADATESSSYFSAQGYLSSREQEG
TESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLKV
KGYPAPRLYWFKDGQPLTASAHIRMTDKKILHTL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Intracellular calcium current disorder and disease phenotype in OBSCN mutant iPSC-based cardiomyocytes in arrhythmogenic right ventricular cardiomyopathy
The Sydney Heart Bank: improving translational research while eliminating or reducing the use of animal models of human heart disease
Chen P, Xiao Y, Wang Y, Zheng Z, Chen L, Yang X, Li J, Wu W, Zhang S
Theranostics 2020;10(24):11215-11229
Theranostics 2020;10(24):11215-11229
The Sydney Heart Bank: improving translational research while eliminating or reducing the use of animal models of human heart disease
dos Remedios C, Lal S, Li A, McNamara J, Keogh A, Macdonald P, Cooke R, Ehler E, Knöll R, Marston S, Stelzer J, Granzier H, Bezzina C, van Dijk S, De Man F, Stienen G, Odeberg J, Pontén F, Linke W, van der Velden J
Biophysical Reviews 2017;9(4):431-441
Biophysical Reviews 2017;9(4):431-441
No comments: Submit comment
No validations: Submit validation data