HPA021186

OBSCN antibody from Atlas Antibodies
ARHGEF30, KIAA1556, KIAA1639, UNC89
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021186
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021186, RRID:AB_1854761
Product name
Anti-OBSCN
Provider product page
Atlas Antibodies - HPA021186
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ACVVVSGSESEAESSSGGELDDAFRRAARRLHRLF
RTKSPAEVSDEELFLSADEGPAEPEEPADWQTYRE
DEHFICIRFEALTEARQAVTRFQEMFATLGIGVEI
KLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSD
AAP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -