HPA019497

OBSCN antibody from Sigma-Aldrich
ARHGEF30, KIAA1556, KIAA1639, UNC89
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019497
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019497, RRID:AB_1854760
Product name
Anti-OBSCN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019497
Antibody type
Polyclonal
Antigen
Obscurin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVDLTSTDYDTAADATESSSYFSAQGYLSSREQEG
TESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLKV
KGYPAPRLYWFKDGQPLTASAHIRMTDKKILHTL
Storage
-20C
Provider Type Product Number
- No reagents -