HPA006026

PTPRJ antibody from Atlas Antibodies
CD148, DEP1, HPTPeta
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006026
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006026, RRID:AB_1078446
Product name
Anti-PTPRJ
Provider product page
Atlas Antibodies - HPA006026
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSNATQVVTDIGITDATVTELIPGSSYTVEIFAQV
GDGIKSLEPGRKSFCTDPASMASFDCEVVPKEPAL
VLKWTCPPGANAGFELEVSSGAWNNATHLESCSSE
NGTEYRTEVTYLNFSTSYNISITTVSCGKMAAPTR
NTCTTG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -