HPA006026

PTPRJ antibody from Sigma-Aldrich
CD148, DEP1, HPTPeta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006026
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006026, RRID:AB_1078446
Product name
Anti-PTPRJ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006026
Antibody type
Polyclonal
Antigen
Receptor-type tyrosine-protein phosphatase eta precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSNATQVVTDIGITDATVTELIPGSSYTVEIFAQV
GDGIKSLEPGRKSFCTDPASMASFDCEVVPKEPAL
VLKWTCPPGANAGFELEVSSGAWNNATHLESCSSE
NGTEYRTEVTYLNFSTSYNISITTVSCGKMAAPTR
NTCTTG
Storage
-20C
Provider Type Product Number
- No reagents -