HPA003346

PLCH2 antibody from Sigma-Aldrich
KIAA0450, PLC-eta2, PLCeta2, PLCL4, RP3-395M20.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003346
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003346, RRID:AB_1079608
Product name
Anti-PLCH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003346
Antibody type
Polyclonal
Antigen
1-Phosphatidylinositol-4,5-bisphosphate phosphodiesterase eta-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNLRATGQRPPIPDELQPRSLAPRMAGLPFRPPWG
CLSLVGVQDCPVAAKSKSLGDLTADDFAPSFEGGS
RRLSHSLGLPGGTRRVSGPGVRRDTLTEQLRWLTV
FQQAGD
Storage
-20C
Provider Type Product Number
- No reagents -