WH0009214M1

FCMR antibody from Sigma-Aldrich
FAIM3, TOSO
ELISA
Recommended by provider

Antibody data

Product number
WH0009214M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0009214M1, RRID:AB_1841556
Product name
Monoclonal Anti-FAIM3 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0009214M1
Antibody type
Monoclonal
Antigen
FAIM3 (AAH06401, a.a. 124-223) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSK
FVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRA
SSVAGDKPRTFLPSTTASKISALEGLLKPQ (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -