Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009214-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009214-M01, RRID:AB_581624
- Product name
- FAIM3 monoclonal antibody (M01), clone 1E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FAIM3.
- Antigen sequence
SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSK
FVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRA
SSVAGDKPRTFLPSTTASKISALEGLLKPQ- Isotype
- IgG
- Antibody clone number
- 1E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Toso, a functional IgM receptor, is regulated by IL-2 in T and NK cells.
Enhanced levels of both the membrane-bound and soluble forms of IgM Fc receptor (FcμR) in patients with chronic lymphocytic leukemia.
SAGE analysis demonstrates increased expression of TOSO contributing to Fas-mediated resistance in CLL.
Murakami Y, Narayanan S, Su S, Childs R, Krzewski K, Borrego F, Weck J, Coligan JE
Journal of immunology (Baltimore, Md. : 1950) 2012 Jul 15;189(2):587-97
Journal of immunology (Baltimore, Md. : 1950) 2012 Jul 15;189(2):587-97
Enhanced levels of both the membrane-bound and soluble forms of IgM Fc receptor (FcμR) in patients with chronic lymphocytic leukemia.
Li FJ, Kubagawa Y, McCollum MK, Wilson L, Motohashi T, Bertoli LF, Barton JC, Barnes S, Davis RS, Kubagawa H
Blood 2011 Nov 3;118(18):4902-9
Blood 2011 Nov 3;118(18):4902-9
SAGE analysis demonstrates increased expression of TOSO contributing to Fas-mediated resistance in CLL.
Proto-Siqueira R, Panepucci RA, Careta FP, Lee A, Clear A, Morris K, Owen C, Rizzatti EG, Silva WA Jr, Falcão RP, Zago MA, Gribben JG
Blood 2008 Jul 15;112(2):394-7
Blood 2008 Jul 15;112(2):394-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FAIM3 monoclonal antibody (M01), clone 1E4 Western Blot analysis of FAIM3 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FAIM3 expression in transfected 293T cell line by FAIM3 monoclonal antibody (M01), clone 1E4.Lane 1: FAIM3 transfected lysate(43.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FAIM3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol