HPA003910

FCMR antibody from Sigma-Aldrich
FAIM3, TOSO
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003910
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003910, RRID:AB_1078798
Product name
Anti-FAIM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003910
Antibody type
Polyclonal
Antigen
Fas apoptotic inhibitory molecule 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPY
LFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPT
TQITHRPRVSRASSVAGDKPRTFLPSTTASKISAL
EGLLKPQTPSYNHHTRLHRQRALDYGSQSGRE
Storage
-20C
Provider Type Product Number
- No reagents -