HPA016459

KDELR2 antibody from Sigma-Aldrich
ELP-1, ERD2.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016459
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016459, RRID:AB_1852180
Product name
Anti-KDELR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016459
Antibody type
Polyclonal
Antigen
ER lumen protein retaining receptor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRH
KMLDTENQKLNSFVADSHQWLCK
Storage
-20C
Provider Type Product Number
- No reagents -