HPA016459

KDELR2 antibody from Atlas Antibodies
ELP-1, ERD2.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016459
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016459, RRID:AB_1852180
Product name
Anti-KDELR2
Provider product page
Atlas Antibodies - HPA016459
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YSRERSSVCQHKCQRPSPASVLQGARTEFLPQQRH
KMLDTENQKLNSFVADSHQWLCK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -