SAB1401554

KDELR2 antibody from Sigma-Aldrich
ELP-1, ERD2.2
No application information provided.

Antibody data

Product number
SAB1401554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401554, RRID:AB_10611011
Product name
Anti-KDELR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1401554
Antibody type
Polyclonal
Antigen
KDELR2 (NP_006845.1, 1 a.a. ~ 212 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGK
SQLLFALVFTTRYLDLFTSFISLYNTSMKVIYLAC
SYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGL
SFLVNHDFSPLEILWTFSIYLESVAILPQLFMISK
TGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGF
FDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSL
PA
Storage
-20C
Provider Type Product Number
- No reagents -