HPA001934

FBLN2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001934
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001934, RRID:AB_1078827
Product name
Anti-FBLN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001934
Antibody type
Polyclonal
Antigen
Fibulin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLGSFHCYKALTCEPGYALKDGECEDVDECAMGTH
TCQPGFLCQNTKGSFYCQARQRCMDGFLQDPEGNC
VDINECTSLSEPCRPGFSCINTVGSYTCQRNPLIC
ARGYHASDDGTKCVDVNE
Storage
-20C
Provider Type Product Number
- No reagents -