HPA007718

AGBL2 antibody from Atlas Antibodies
CCP2, FLJ23598
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007718
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007718, RRID:AB_1078110
Product name
Anti-AGBL2
Provider product page
Atlas Antibodies - HPA007718
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQ
IEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPA
SAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPR
LREPQELFSILSTKRPLQAPRWPIECEVIKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -