HPA007718

AGBL2 antibody from Sigma-Aldrich
CCP2, FLJ23598
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007718
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007718, RRID:AB_1078110
Product name
Anti-AGBL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007718
Antibody type
Polyclonal
Antigen
Cytosolic carboxypeptidase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLNGSLGEKDDLIPDTLQKEKLLWPISLSSAVHRQ
IEAINRDFHSCLGWMQWRGLSSLQPPPPRFKDSPA
SAFRVAGITDSHMLSLPHLRSRQLLYDELDEVNPR
LREPQELFSILSTKRPLQAPRWPIECEVIKE
Storage
-20C
Provider Type Product Number
- No reagents -