Antibody data

Product number
H00008601-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008601-M04, RRID:AB_1579735
Product name
RGS20 monoclonal antibody (M04), clone 3E10
Provider product page
Abnova Corporation - H00008601-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RGS20.
Antigen sequence
NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAW
AQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMA
CEELKKEANKNIIEEKARIIYEDYISILS
Isotype
IgG
Antibody clone number
3E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -