HPA012634

CLMN antibody from Sigma-Aldrich
FLJ12383, KIAA0500, KIAA1188
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012634, RRID:AB_1846973
Product name
Anti-CLMN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012634
Antibody type
Polyclonal
Antigen
Calmin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FEGSPRVAKESLRQDGHVLAVEVAEEKEQKQESSK
IPESSSDKVAGDIFLVEGTNNNSQSSSCNGALEST
ARHDEESHSLSPPGENTVMADSFQIKVNLMTVEAL
EEG
Storage
-20C
Provider Type Product Number
- No reagents -