HPA012634

CLMN antibody from Atlas Antibodies
FLJ12383, KIAA0500, KIAA1188
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012634
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012634, RRID:AB_1846973
Product name
Anti-CLMN
Provider product page
Atlas Antibodies - HPA012634
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FEGSPRVAKESLRQDGHVLAVEVAEEKEQKQESSK
IPESSSDKVAGDIFLVEGTNNNSQSSSCNGALEST
ARHDEESHSLSPPGENTVMADSFQIKVNLMTVEAL
EEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -