Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183032 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ring Finger Protein 141 (RNF141) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RNF141 antibody: synthetic peptide directed towards the middle region of human RNF141
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
RIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDEN
SSSVT SCQASLWMGR- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A new mutant transcript generated in Znf230 exon 2 knockout mice reveals a potential exon structure in the targeting vector sequence.
Molecular cloning and characterization of a mouse spermatogenesis-related ring finger gene znf230.
Liu Y, Tao D, Ma S, Kuang Y, Su D, Zhang H, Yang Y, Ma Y, Zhang S
Acta biochimica et biophysica Sinica 2013 Feb;45(2):123-8
Acta biochimica et biophysica Sinica 2013 Feb;45(2):123-8
Molecular cloning and characterization of a mouse spermatogenesis-related ring finger gene znf230.
Qiu W, Zhang S, Xiao C, Xu W, Ma Y, Liu Y, Wu Q
Biochemical and biophysical research communications 2003 Jun 27;306(2):347-53
Biochemical and biophysical research communications 2003 Jun 27;306(2):347-53
No comments: Submit comment
No validations: Submit validation data