HPA018133

RNF141 antibody from Sigma-Aldrich
ZFP26, ZNF230
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018133
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018133, RRID:AB_1859142
Product name
Anti-RNF141 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018133
Antibody type
Polyclonal
Antigen
RING finger protein 141 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAE
LNDVTAKVASGQEKHLLFEVQPGSDSSAFWKVVVR
VVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQA
AGVLAQSSTSEEPDENSSSVTSCQASLWMGRVKQL
TDE
Storage
-20C
Provider Type Product Number
- No reagents -