Antibody data

Product number
PAB21864
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21864, RRID:AB_10966263
Product name
FLJ45032 polyclonal antibody
Provider product page
Abnova Corporation - PAB21864
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FLJ45032.
Antigen sequence
WFALLESLHVQPLHNENVKISATRAQRGGGGSGSG
SEDEDWICLAGVDDIEADILHYSGHGMDLDKALEG
CSPDHTIILLAHQPLAAKRALQARPDINLILSGHT
HAGQIF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -