HPA027019

TMPPE antibody from Sigma-Aldrich
FLJ45032
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027019
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027019, RRID:AB_1848942
Product name
Anti-TMPPE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027019
Antibody type
Polyclonal
Antigen
Putative metallophosphoesterase FLJ45032 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WFALLESLHVQPLHNENVKISATRAQRGGGGSGSG
SEDEDWICLAGVDDIEADILHYSGHGMDLDKALEG
CSPDHTIILLAHQPLAAKRALQARPDINLILSGHT
HAGQIF
Storage
-20C
Provider Type Product Number
- No reagents -