HPA018842

LIAS antibody from Sigma-Aldrich
LAS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018842
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018842, RRID:AB_1852864
Product name
Anti-LIAS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018842
Antibody type
Polyclonal
Antigen
Lipoyl synthase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIML
GLGENDEQVYATMKALREADVDCLTLGQYMQPTRR
HLK
Storage
-20C
Provider Type Product Number
- No reagents -