HPA019076

LIAS antibody from MilliporeSigma / Merck KGaA
LAS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019076
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019076, RRID:AB_1852866
Product name
Anti-LIAS antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019076
Antibody type
Polyclonal
Antigen
Lipoyl synthase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVKTARNPPPLDASEPYNTAKAIAEWGLDYVVLTS
VDRDDMPDGGAEHIAKTVSYLKER
Storage
-20C
Provider Type Product Number
- No reagents -