Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002079-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002079-M07, RRID:AB_518796
- Product name
- ERH monoclonal antibody (M07), clone 1H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ERH.
- Antigen sequence
MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKM
YEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCL
VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK- Isotype
- IgG
- Antibody clone number
- 1H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A genotoxic stress-responsive miRNA, miR-574-3p, delays cell growth by suppressing the enhancer of rudimentary homolog gene in vitro.
Ishikawa K, Ishikawa A, Shoji Y, Imai T
International journal of molecular sciences 2014 Feb 20;15(2):2971-90
International journal of molecular sciences 2014 Feb 20;15(2):2971-90
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ERH is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol