HPA002567

ERH antibody from Sigma-Aldrich
DROER
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002567
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002567, RRID:AB_1078749
Product name
Anti-ERH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002567
Antibody type
Polyclonal
Antigen
Enhancer of rudimentary homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLK
RMNPNSPSITYDISQLFDFIDDLADLSCLVYRADT
QTYQPYNKDWIKEKIYVLLRRQAQQAGK
Storage
-20C
Provider Type Product Number
- No reagents -