HPA002732

ZNF544 antibody from Sigma-Aldrich
AF020591
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002732
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002732, RRID:AB_1080735
Product name
Anti-ZNF544 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002732
Antibody type
Polyclonal
Antigen
Zinc finger protein 544 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HQRTHTGEKPYECNLCGKSFSQSSKLITHQRIHTG
EKPYQCIECGKSFRWNSNLVIHQRIHTGEKPYDCT
HCGKSFSQSYQLVAHKRTHTGEKPYECNECGKAFN
RSTQLIRHLQIHTGEKPYKCNQCNKA
Storage
-20C
Provider Type Product Number
- No reagents -