Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011074-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011074-A01, RRID:AB_463047
- Product name
- TRIM31 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant TRIM31.
- Antigen sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNF
CLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSL
LRNLVEKIQALQASEVQSKRKEATCPRHQE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TRIM31 polyclonal antibody (A01), Lot # 051101JC01 Western Blot analysis of TRIM31 expression in HL-60 ( Cat # L014V1 ).