HPA025072

XKR4 antibody from Sigma-Aldrich
KIAA1889
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025072
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025072, RRID:AB_1858886
Product name
Anti-XKR4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025072
Antibody type
Polyclonal
Antigen
XK-related protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVHDFSTEDSATAAAASSCPQPGADCKTVVGGGSA
AGEGEARPSTPQRQASNASKSNIAAANSGSNSSGA
TRASGKHRS
Storage
-20C
Provider Type Product Number
- No reagents -