HPA028083

XKR4 antibody from Sigma-Aldrich
KIAA1889
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028083
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028083, RRID:AB_10601025
Product name
Anti-XKR4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028083
Antibody type
Polyclonal
Antigen
XK, Kell blood group complex subunit-related family, member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YAFFHPNGPRFGQSPSCACEDPAAAFTLPPDVATS
TLRSISNNRSVVSDRDQKFAERDGCVPVFQVRPTA
PSTPSSRPPRIEESVIKIDLFR
Storage
-20C
Provider Type Product Number
- No reagents -