HPA003967

UBP1 antibody from Sigma-Aldrich
LBP-1a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003967
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003967, RRID:AB_10601829
Product name
Anti-UBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003967
Antibody type
Polyclonal
Antigen
upstream binding protein 1 (LBP-1a) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPNHQ
GDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTR
LFSNFSGADLLKLTKEDLVQICGAADGIRLYNSLK
SRSVRPRLTIYVCREQPSSTVLQGQQQAASSASEN
GSGA
Storage
-20C
Provider Type Product Number
- No reagents -