Antibody data

Product number
HPA025024
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025024, RRID:AB_1854330
Product name
Anti-TGS1
Provider product page
Atlas Antibodies - HPA025024
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEK
IAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALT
GMRVIAIDIDPVKIALARNNAE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.