HPA016601

NEB antibody from Sigma-Aldrich
NEB177D, NEM2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016601
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016601, RRID:AB_1854361
Product name
Anti-NEB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016601
Antibody type
Polyclonal
Antigen
Nebulin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTPDMLRAKNATQILNEKEYKRDLELEVKGRGLNA
MANETPDFMRARNATDIASQIKYKQSAEMEKANFT
SVVDTPEIIHAQQVKNLSSQKKYKEDAEKSMSYYE
TVLDTPEIQRVRENQKNFSLLQYQCDL
Storage
-20C
Provider Type Product Number
- No reagents -