HPA024026

GBA2 antibody from Atlas Antibodies
AD035, DKFZp762K054, KIAA1605, SPG46
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024026
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024026, RRID:AB_1849530
Product name
Anti-GBA2
Provider product page
Atlas Antibodies - HPA024026
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWP
VCLAVMESEMKFDKDHDGLIENGGYADQTYDGWVT
TGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDKFS
SILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMS
DQCA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -