H00057704-B01P

GBA2 antibody from Abnova Corporation
AD035, DKFZp762K054, KIAA1605, SPG46

Antibody data

Product number
H00057704-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057704-B01P, RRID:AB_1573691
Product name
GBA2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00057704-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GBA2 protein.
Antigen sequence
MGTQDPGNMGTGVPASEQISCAKEDPQVYCPEETG
GTKDVQVTDCKSPEDSRPPKETDCCNPEDSGQLMV
SYEGKAMGYQVPPFGWRICLAHEFTEKRKPFQANN
VSLSNMIKHIGMGLRYLQWWYRKTHVEKKTPFIDM
INSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQL
NPGMYQHRTVIADQFTVCLRREGQTVYQQVLSLER
PSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQN
VTLTCRQITPILPHDYQDSSLPVGVFVWDVENEGD
EALDVSIMFSMRNGLGGGDDAPGGLWNEPFCLERS
GETVRGLLLHHPTLPNPYTMAVAARVTAATTVTHI
TAFDPDSTGQQVWQDLLQDGQLDSPTGQSTPTQKG
VGIAGAVCVSSKLRPRGQCRLEFSLAWDMPRIMFG
AKGQVHYRRYTRFFGQDGDAAPALSHYALCRYAEW
EERISAWQSPVLDDRSLPAWYKSALFNELYFLADG
GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGY
LEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQY
DMALATLREDLTRRRYLMSGVMAPVKRRNVIPHDI
GDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYR
DYYLTGDQNFLKDMWPVCLAVMESEMKFDKDHDGL
IENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMV
QMAALCGAQDIQDKFSSILSRGQEAYERLLWNGRY
YNYDSSSRPQSRSVMSDQCAGQWFLKACGLGEGDT
EVFPTQHVVRALQTIFELNVQAFAGGAMGAVNGMQ
PHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWE
GFQTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSL
AYMRPLSIWAMQLALQQQQHKKASWPKVKQGTGLR
TGPMFGPKEAMANLSPE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -