HPA024026

GBA2 antibody from Sigma-Aldrich
AD035, DKFZp762K054, KIAA1605, SPG46
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024026
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024026, RRID:AB_1849530
Product name
Anti-GBA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024026
Antibody type
Polyclonal
Antigen
Non-lysosomal glucosylceramidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWP
VCLAVMESEMKFDKDHDGLIENGGYADQTYDGWVT
TGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDKFS
SILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMS
DQCA
Storage
-20C
Provider Type Product Number
- No reagents -