HPA023544

DUOX1 antibody from MilliporeSigma / Merck KGaA
LNOX1, NOXEF1, THOX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023544
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023544, RRID:AB_1847878
Product name
Anti-DUOX1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023544
Antibody type
Polyclonal
Antigen
Dual oxidase 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVP
EVIKDLCRRASYISQDMICPSPRVSARCSRSDIET
ELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP
Storage
-20C
Provider Type Product Number
- No reagents -