Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487273 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-phosphodiesterase 4B, CAMP-Specific (PDE4B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PDE4B antibody: synthetic peptide directed towards the middle region of human PDE4B
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQG
LMEKF QFELTLDEED- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references PDE4B polymorphisms and decreased PDE4B expression are associated with schizophrenia.
Prenatal cerebral development in individuals at genetic risk for psychosis: head size at birth in offspring of women with schizophrenia.
Fatemi SH, King DP, Reutiman TJ, Folsom TD, Laurence JA, Lee S, Fan YT, Paciga SA, Conti M, Menniti FS
Schizophrenia research 2008 Apr;101(1-3):36-49
Schizophrenia research 2008 Apr;101(1-3):36-49
Prenatal cerebral development in individuals at genetic risk for psychosis: head size at birth in offspring of women with schizophrenia.
McNeil TF, Cantor-Graae E, Cardenal S
Schizophrenia research 1993 Jun;10(1):1-5
Schizophrenia research 1993 Jun;10(1):1-5
No comments: Submit comment
No validations: Submit validation data