PAB21641

CATSPERD antibody from Abnova Corporation
MGC39581, TMEM146

Antibody data

Product number
PAB21641
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21641, RRID:AB_10965086
Product name
CATSPERD polyclonal antibody
Provider product page
Abnova Corporation - PAB21641
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CATSPERD.
Antigen sequence
RTDSNFTSSLKKATMSTLTVDIANKEISCVDIKPL
STLISVGCDLDKKIVIQNKVSACSMGILDPLTLQD
NYSFIIEKEFYDPGFQGQQSSEDLHVFYSYQQLGC
PLLVYYDTLWKPVV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -