SAB2102457

CATSPERD antibody from MilliporeSigma / Merck KGaA
MGC39581, TMEM146
No application information provided.

Antibody data

Product number
SAB2102457
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2102457, RRID:AB_10606815
Product name
Anti-TMEM146 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2102457
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_689997.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQ
VFFTMDNFETSLLPF
Storage
-20C
Provider Type Product Number
- No reagents -