HPA024181

SIPA1L2 antibody from Sigma-Aldrich
KIAA1389
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024181
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024181, RRID:AB_1856886
Product name
Anti-SIPA1L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024181
Antibody type
Polyclonal
Antigen
Signal-induced proliferation-associated 1-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEE
PEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQH
VLSKEDFLKLMLPD
Storage
-20C
Provider Type Product Number
- No reagents -