HPA001632

PAG1 antibody from Sigma-Aldrich
CBP, PAG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001632
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001632, RRID:AB_1079557
Product name
Anti-PAG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001632
Antibody type
Polyclonal
Antigen
Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVPVKLLDENENLQEKEGGEAEESATDTTSETNKR
FSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVN
KSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVK
DFEKTPNSTLPPAG
Storage
-20C
Provider Type Product Number
- No reagents -