HPA021937

CLEC10A antibody from Atlas Antibodies
CD301, CLECSF13, CLECSF14, HML, HML2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021937
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021937, RRID:AB_1846905
Product name
Anti-CLEC10A
Provider product page
Atlas Antibodies - HPA021937
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAH
LVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKW
VDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHF
HPDGRWND
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -