H00010462-B01P

CLEC10A antibody from Abnova Corporation
CD301, CLECSF13, CLECSF14, HML, HML2

Antibody data

Product number
H00010462-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010462-B01P, RRID:AB_1673242
Product name
CLEC10A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010462-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CLEC10A protein.
Antigen sequence
MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLC
SGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLV
TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLK
AEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPS
VCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNAS
TEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQ
LKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPE
GAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGE
DCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQES
H
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -