HPA021937

CLEC10A antibody from Sigma-Aldrich
CD301, CLECSF13, CLECSF14, HML, HML2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021937
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021937, RRID:AB_1846905
Product name
Anti-CLEC10A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021937
Antibody type
Polyclonal
Antigen
C-type lectin domain family 10 member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAH
LVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKW
VDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHF
HPDGRWND
Storage
-20C
Provider Type Product Number
- No reagents -