Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005609-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005609-M04, RRID:AB_534926
- Product name
- MAP2K7 monoclonal antibody (M04), clone 2G5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAP2K7.
- Antigen sequence
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDIS
PQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPAR
PRHMLGLPSTLFTPRSMESIEIDQKLQEI- Isotype
- IgG
- Antibody clone number
- 2G5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MAP2K7 expression in transfected 293T cell line by MAP2K7 monoclonal antibody (M04), clone 2G5.Lane 1: MAP2K7 transfected lysate(47.485 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MAP2K7 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MAP2K7 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAPK8 and MAP2K7. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-MAP2K7 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)