HPA001633

MAP2K7 antibody from Atlas Antibodies
Jnkk2, MKK7, PRKMK7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001633
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001633, RRID:AB_611980
Product name
Anti-MAP2K7
Provider product page
Atlas Antibodies - HPA001633
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIR
ADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQ
EEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYN
KLLEHSFIKRYETMEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -