HPA001633

MAP2K7 antibody from Sigma-Aldrich
Jnkk2, MKK7, PRKMK7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001633, RRID:AB_1079516
Product name
Anti-MAP2K7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001633
Antibody type
Polyclonal
Antigen
Dual specificity mitogen-activated protein kinase kinase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIR
ADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQ
EEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYN
KLLEHSFIKRYETMEV
Storage
-20C
Provider Type Product Number
- No reagents -