WH0195814M1

SDR16C5 antibody from Sigma-Aldrich
EPHD-2, RDH-E2, RDHE2
ELISA
Recommended by provider

Antibody data

Product number
WH0195814M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0195814M1, RRID:AB_1843306
Product name
Monoclonal Anti-RDHE2 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0195814M1
Antibody type
Monoclonal
Antigen
RDHE2 (AAH37219, a.a. 26-310) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
MIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF
ARLGSVLVLWDINKEGNEETCKMAREAGATRVHAY
TCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVT
GKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMI
ANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGF
AESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCT
TGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKL
LYFMMFLKSF (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -