HPA025224

SDR16C5 antibody from Atlas Antibodies
EPHD-2, RDH-E2, RDHE2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025224
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025224, RRID:AB_1856163
Product name
Anti-SDR16C5
Provider product page
Atlas Antibodies - HPA025224
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMP
KLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFV
DQKKKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -